Recombinant Human Interleukin-1 alpha; 10ug

$205.00

SKU: 44-IL1a Categories: ,

Description

Recombinant Human Interleukin-1 alpha; 10ug

Other Sizes are available please ask for Quote

Synonyms: Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 alpha,IL1, IL-1A, IL1F1.

Introduction: IL-1 alpha is produced by activated macrophages, stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1A proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Description: Interleukin-1 alpha Human Recombinant produced in E. coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18 kDa.

Source: Escherichia coli.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Tris-HCL, pH=8, 5mM MgCl2 and 10% glycerol.

Solubility: It is recommended to reconstitute the lyophilized Interleukin 1 alpha in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Stability: Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -20°C.

Please prevent multiple freeze-thaw cycles.

Purity: Greater than 95.0% as determined by SDS-PAGE.

Amino acid sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.

Biological Activity: The ED50 as determined by the dose-dependent stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1 x 109 IU/mg.

Usage: Unless otherwise mentioned in the product description this product is intended for LABORATORY RESEARCH USE ONLY

Additional information

Weight 1 lbs