Description
Recombinant Human Interleukin-13, (IL-13 Human); 10ug
Product Data Sheet and Certificate of Analysis
Synonyms: NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.
Description: Interleukin-13 Human Recombinant protein produced in E. coli is a single, non-glycosylated polypeptide chain containing 114 amino acids and having a molecular mass of 12.5 kDa.
Source: Escherichia coli
Physical Appearance: Sterile filtered white lyophilized (freeze-dried) powder.
Formulation: The protein (1mg/ml) was lyophilized with 1X PBS pH-7.2.
Solubility: It is recommended to reconstitute the lyophilized Interleukin 13 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability: Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -20°C. Upon reconstitution IL13 should be stored at -20°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent multiple freeze-thaw cycles.
Purity:
Greater than 95% as determined by: SDS-PAGE
Amino acid sequence:
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.
Biological Activity:
The ED50 was determined by the dose dependent prolifiration of TF-1 cells and was found to be < 1ng/ml, corresponding to a specific activity of >1 x 106.
Protein content:
Protein quantitation was carried out by independent methods.
Usage:
Unless otherwise mentioned in the product description this product is intended for LABORATORY RESEARCH USE ONLY.
Additional information
| Weight | 1 lbs |
|---|

